Pfam domain
Pfam family: Cdc6_C (PF09079.10)
Uniprot AC: Q97WM8
RecName: ORC1-type DNA replication protein 3
Begin-End: 299-374
Organism: Sulfolobus solfataricus
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 

Sequence:
ALRSLIESEDVMSAHKMYTDLCNKFKQKPLSYRRFSDIISELDMFGIVKIRIINRGRAGG
VKKYALVEDKEKVLRA
Structures of the domain Q97WM8 299-374
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2qby X-ray 3.35 B 312-373  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2019

text