Pfam domain
Pfam family: EIF_2_alpha (PF07541.11)
Uniprot AC: Q97Z79
RecName: Translation initiation factor 2 subunit alpha
Begin-End: 121-235
Organism: Sulfolobus solfataricus
Interaction Mode:   

Sequence:
AWEQVAWKLEAKYGDPITAIEKAVKEGEKILIDAGVPEIWVKPLLEEASKHAEERKVKMS
GLITVRTNEPLGVEKIKEVISKALENIEQDYESLLNIKIYTIGAPRYRVDVVGTN
Structures of the domain Q97Z79 121-235
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3v11 X-ray 5 B 122-232 None
5jb3 X-ray 5.34 9 122-232 None


© NPIDB team 2003 - 2019

text