Pfam domain
Pfam family: Cren7 (PF11520.7)
Uniprot AC: Q97ZE3
RecName: Chromatin protein Cren7
Begin-End: 6-59
Organism: Sulfolobus solfataricus
Interaction Mode:   

Sequence:
KPVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYP
Structures of the domain Q97ZE3 6-59
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5wvw X-ray 1.8 A 4-59 None
5wvw X-ray 1.8 B 4-59 None
5wwc X-ray 1.9 A 5-59 None
5wwc X-ray 1.9 B 3-59 None
4r55 X-ray 1.8 A 4-54 None
3kxt X-ray 1.6 A 6-59 None
5k17 X-ray 2.1 A 3-59 None
5k17 X-ray 2.1 B 3-59 None
3lwi X-ray 2.3 A 4-59 None
3lwi X-ray 2.3 B 4-59 None
3lwh X-ray 1.9 A 3-59 None
5k07 X-ray 2 A 5-59 None
4r56 X-ray 2.3 B 3-59 None
4r56 X-ray 2.3 A 3-59 None
5wvz X-ray 2.3 A 3-59 None
5wvz X-ray 2.3 B 3-59 None
5wvy X-ray 2 A 3-59 None
5wvy X-ray 2 B 3-59 None


© NPIDB team 2003 - 2019

text