Pfam domain
Pfam family: SRP_SPB (PF02978.18)
Uniprot AC: Q97ZE7
RecName: Signal recognition particle 54 kDa protein
Begin-End: 326-428
Organism: Sulfolobus solfataricus
Interaction Mode:   

Sequence:
KLTLRDVYAQIIALRKMGPLSKVLQHIPGLGIMLPTPSEDQLKIGEEKIRRWLAALNSMT
YKELENPNIIDKSRMRRIAEGSGLEVEEVRELLEWYNNMNRLL
Structures of the domain Q97ZE7 326-428
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1qzw X-ray 4.1 G 327-427 None
1qzw X-ray 4.1 E 327-427 None
1qzw X-ray 4.1 C 327-427 None
1qzw X-ray 4.1 A 327-427 None
2iy3 X-ray 16 A 327-427 None
3zn8 X-ray 12 M 327-427 None


© NPIDB team 2003 - 2019

text