Pfam domain
Pfam family: Nop (PF01798.17)
Uniprot AC: Q97ZH3
RecName: Pre mRNA splicing protein
Begin-End: 146-373
Organism: Sulfolobus solfataricus
Interaction Mode:   

Sequence:
AMDDIDKTINLFSERLREWYSIHFPELDKLIEDHEEYATIVSRFGDRGFLTIDSLKELGF
NEQRINRILDAAKKSIGADISEDDLSAMRMIANTILDLYNIRRNLNNYLEGVMKEVAPNV
TALVGPALGARLLSIAGSLDELAKMPASTIQVLGAEKALFRALRSGGRPPKHGIIFQYPA
IHTSPRWQRGKIARALAAKLAIAARVDAFSGRFIGDQLNEQLKKRIDE
Structures of the domain Q97ZH3 146-373
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3id5 X-ray 4.01 E 147-372 None
3id5 X-ray 4.01 A 147-372 None
5gip X-ray 3.13 A 147-372 None
5gip X-ray 3.13 B 147-372 None
5gip X-ray 3.13 L 147-372 None
5gip X-ray 3.13 K 147-372 None
3pla X-ray 3.15 K 147-372 None
3pla X-ray 3.15 A 147-372 None
3pla X-ray 3.15 A 147-372 None
3pla X-ray 3.15 B 147-372 None


© NPIDB team 2003 - 2019

text