Pfam domain
Pfam family: Cdc6_C (PF09079.10)
Uniprot AC: Q980N4
RecName: ORC1-type DNA replication protein 1
Begin-End: 303-384
Organism: Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Interaction Mode:  H-Bb H-Mj S-Bb S-Mn L-Bb L-Mj L-Mn 

Sequence:
LMAVVSISSEENVVSTTGAVYETYLNICKKLGVEAVTQRRVSDIINELDMVGILTAKVVN
RGRYGKTKEIGLAVDKNIIVRS
Structures of the domain Q980N4 303-384
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2qby X-ray 3.35 A 317-382  H-Bb H-Mj S-Bb S-Mn L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2018

text