Pfam domain
Pfam family: T_Ag_DNA_bind (PF02217.15)
Uniprot AC: Q98ZP7
RecName: Truncated large tumor antigen
Begin-End: 136-229
Organism: Simian virus 40
Interaction Mode:  H-Bb S-Bb S-Mj L-Bb L-Mj 

Sequence:
KDFPSELLSFLSHAVFSNRTLACFAIYTTKEKAALLYKKIMEKYSVTFISRHNSYNHNIL
FFLTPHRHRVSAINNYAQKLCTFSFLICKGVNKE
Structures of the domain Q98ZP7 136-229
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2nl8 X-ray 2.3 A 136-229 None
2ntc X-ray 2.4 B 136-229  H-Bb S-Bb S-Mj L-Bb L-Mj 
2ntc X-ray 2.4 A 136-229  H-Bb S-Bb S-Mj L-Bb L-Mj 
2itl X-ray 1.65 B 136-229  H-Bb S-Bb S-Mj L-Bb L-Mj 
2itl X-ray 1.65 A 136-229  S-Bb S-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2019

text