Pfam domain
Pfam family: mTERF (PF02536.13)
Uniprot AC: Q99551
RecName: Transcription termination factor 1, mitochondrial
Begin-End: 100-389
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
MITNEQDLKMFLLSKGASKEVIASIISRYPRAITRTPENLSKRWDLWRKIVTSDLEIVNI
LERSPESFFRSNNNLNLENNIKFLYSVGLTRKCLCRLLTNAPRTFSNSLDLNKQMVEFLQ
AAGLSLGHNDPADFVRKIIFKNPFILIQSTKRVKANIEFLRSTFNLNSEELLVLICGPGA
EILDLSNDYARRSYANIKEKLFSLGCTEEEVQKFVLSYPDVIFLAEKKFNDKIDCLMEEN
ISISQIIENPRVLDSSISTLKSRIKELVNAGCNLSTLNITLLSWSKKRYE
Structures of the domain Q99551 100-389
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3n7q X-ray 2.4 A 101-389  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2019

text