Pfam domain
Pfam family: mTERF (PF02536.13)
Uniprot AC: Q99551
RecName: Transcription termination factor 1, mitochondrial
Begin-End: 76-389
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
LKNLLTMGVDIDMARKRQPGVFHRMITNEQDLKMFLLSKGASKEVIASIISRYPRAITRT
PENLSKRWDLWRKIVTSDLEIVNILERSPESFFRSNNNLNLENNIKFLYSVGLTRKCLCR
LLTNAPRTFSNSLDLNKQMVEFLQAAGLSLGHNDPADFVRKIIFKNPFILIQSTKRVKAN
IEFLRSTFNLNSEELLVLICGPGAEILDLSNDYARRSYANIKEKLFSLGCTEEEVQKFVL
SYPDVIFLAEKKFNDKIDCLMEENISISQIIENPRVLDSSISTLKSRIKELVNAGCNLST
LNITLLSWSKKRYE
Structures of the domain Q99551 76-389
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3n6s X-ray 3.1 A 76-389  H-Bb H-Mj L-Bb L-Mj 
3n6s X-ray 3.1 A 76-389  H-Bb H-Mj L-Bb L-Mj 
5cky X-ray 2.62 O 76-389  H-Bb H-Mj L-Bb L-Mj 
5crk X-ray 2.48 O 76-389  H-Bb H-Mj L-Bb L-Mj 
5co0 X-ray 2.65 O 76-389  H-Bb H-Mj L-Bb L-Mj 
3mvb X-ray 2.79 O 76-389  H-Bb H-Mj L-Bb L-Mj 
5crj X-ray 2.59 O 76-389  H-Bb H-Mj L-Bb L-Mj 
3mva X-ray 2.2 O 76-389  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2019

text