Pfam domain
Pfam family: Ets (PF00178.21)
Uniprot AC: Q99581
RecName: Protein FEV
Begin-End: 48-127
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
QLWQFLLELLADRANAGCIAWEGGHGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRY
YYDKNIMSKVHGKRYAYRFD
Structures of the domain Q99581 48-127
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3zp5 X-ray 2 A 48-126  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2019

text