Pfam domain
Pfam family: T-box (PF00907.21)
Uniprot AC: Q99593
RecName: T-box transcription factor TBX5
Begin-End: 56-232
Organism: Homo sapiens
Interaction Mode:   

Sequence:
VFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYK
FADNKWSVTGKAEPAMPGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNS
MHKYQPRLHIVKADENNGFGSKNTAFCTHVFPETAFIAVTSYQNHKITQLKIENNPF
Structures of the domain Q99593 56-232
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2x6v X-ray 2.2 B 57-232 None


© NPIDB team 2003 - 2019

text