Pfam domain
Pfam family: T-box (PF00907.21)
Uniprot AC: Q99593
RecName: T-box transcription factor TBX5
Begin-End: 56-238
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mj 

Sequence:
VFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYK
FADNKWSVTGKAEPAMPGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNS
MHKYQPRLHIVKADENNGFGSKNTAFCTHVFPETAFIAVTSYQNHKITQLKIENNPFAKG
FRG
Structures of the domain Q99593 56-238
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2x6v X-ray 2.2 A 57-237  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mj 
4s0h X-ray 2.82 E 57-237  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mj 
4s0h X-ray 2.82 A 57-237 None


© NPIDB team 2003 - 2019

text