Pfam domain
Pfam family: Bac_DNA_binding (PF00216.23)
Uniprot AC: Q99U17
RecName: DNA-binding protein HU
Begin-End: 1-90
Organism: Staphylococcus aureus
Interaction Mode:  S-Bb S-Mn L-Bb 

Sequence:
MNKTDLINAVAEQADLTKKEAGSAVDAVFESIQNSLAKGEKVQLIGFGNFEVRERAARKG
RNPQTGKEIDIPASKVPAFKAGKALKDAVK
Structures of the domain Q99U17 1-90
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4qju X-ray 2.16 A 1-90  S-Bb S-Mn L-Bb 
4qju X-ray 2.16 B 1-90  S-Bb S-Mn L-Bb 


© NPIDB team 2003 - 2021

text