Pfam domain
Pfam family: HNH_4 (PF13395.8)
Uniprot AC: Q99ZW2
RecName: CRISPR-associated endonuclease Cas9/Csn1
Begin-End: 821-872
Organism: Streptococcus pyogenes serotype M1
Interaction Mode:   

Sequence:
DMYVDQELDINRLSDYDVDHIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPS
Structures of the domain Q99ZW2 821-872
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6k57 X-ray 2.98 B 821-872 None
6k3z X-ray 3.2 B 821-872 None
6k4s X-ray 3.01 B 821-872 None
5b2r X-ray 2 B 821-872 None
5b2s X-ray 2.2 B 821-872 None
6k4p X-ray 2.9 B 821-872 None
6ifo X-ray 3.31 B 821-872 None
6ifo X-ray 3.31 A 821-872 None
5xbl X-ray 3.05 A 821-872 None
5fw2 X-ray 2.68 B 821-872 None
6ai6 X-ray 2.7 A 821-872 None
6k4q X-ray 2.7 B 821-872 None
5y36 X-ray 5.2 A 821-872 None
4un3 X-ray 2.59 B 821-872 None
4un4 X-ray 2.37 B 821-872 None
4un5 X-ray 2.4 B 821-872 None
6k4u X-ray 3.2 B 821-872 None
4zt9 X-ray 3.1 A 821-872 None
4zt0 X-ray 2.9 A 821-872 None
4zt0 X-ray 2.9 C 819-875 None
6o0z X-ray 3.3 A 821-872 None
6aeb X-ray 3 B 821-872 None
6aeb X-ray 3 F 821-872 None
5b2t X-ray 2.2 B 821-872 None
6o0y X-ray 3.37 A 821-872 None
6vpc X-ray 3.2 B 1018-1069 None
5fq5 X-ray 2.14 B 821-872 None
4oo8 X-ray 2.5 A 821-872 None
5vzl X-ray 3.9 A 821-872 None
5fw1 X-ray 2.5 B 821-872 None
5f9r X-ray 3.4 B 821-872 None
5fw3 X-ray 2.7 B 821-872 None
5vw1 X-ray 2.6 A 821-872 None
6aeg X-ray 2.7 B 821-872 None


© NPIDB team 2003 - 2021

text