Pfam domain
Pfam family: WD40 (PF00400.31)
Uniprot AC: Q9BIJ5
RecName: LACK protective antigen
Begin-End: 184-222
Organism: Leishmania donovani
Interaction Mode:   

Sequence:
GKCERTLKGHSNYVSTVTVSPDGSLCASGGKDGVALLWD
Structures of the domain Q9BIJ5 184-222
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6az1 X-ray 2.7 g 175-213 None


© NPIDB team 2003 - 2019

text