Pfam domain
Pfam family: tRNA_anti-codon (PF01336.27)
Uniprot AC: Q9BQ15
RecName: SOSS complex subunit B1
Begin-End: 23-104
Organism: Homo sapiens
Interaction Mode:   

Sequence:
VLETGRVTKTKDGHEVRTCKVADKTGSINISVWDDVGNLIQPGDIIRLTKGYASVFKGCL
TLYTGRGGDLQKIGEFCMVYSE
Structures of the domain Q9BQ15 23-104
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5d8f X-ray 2.35 A 22-105 None
5d8f X-ray 2.35 B 22-105 None
4owx X-ray 2.3 B 22-105 None
4oww X-ray 2.3 B 22-105 None


© NPIDB team 2003 - 2021

text