Pfam domain
Pfam family: Ribosomal_L34 (PF00468.16)
Uniprot AC: Q9BQ48
RecName: 39S ribosomal protein L34, mitochondrial
Begin-End: 50-92
Organism: Homo sapiens
Interaction Mode:   

Sequence:
GNEYQPSNIKRKNKHGWVRRLSTPAGVQVILRRMLKGRKSLSH
Structures of the domain Q9BQ48 50-92
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j7y X-ray 3.4 2 51-92 None
5oom X-ray 3.03 2 51-92 None


© NPIDB team 2003 - 2019

text