Pfam domain
Pfam family: DEAD (PF00270.28)
Uniprot AC: Q9BUQ8
RecName: Probable ATP-dependent RNA helicase DDX23
Begin-End: 415-616
Organism: Homo sapiens
Interaction Mode:   

Sequence:
TPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLVWITTLPKIDRIEESDQGPYAIIL
APTRELAQQIEEETIKFGKPLGIRTVAVIGGISREDQGFRLRMGCEIVIATPGRLIDVLE
NRYLVLSRCTYVVLDEADRMIDMGFEPDVQKILEHMPVSNQKPDTDEAEDPEKMLANFES
GKHKYRQTVMFTATMPPAVERL
Structures of the domain Q9BUQ8 415-616
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jcr X-ray 7 F 415-616 None


© NPIDB team 2003 - 2019

text