Pfam domain
Pfam family: Helicase_C (PF00271.30)
Uniprot AC: Q9BUQ8
RecName: Probable ATP-dependent RNA helicase DDX23
Begin-End: 650-759
Organism: Homo sapiens
Interaction Mode:   

Sequence:
EKRKKLLAILEQGFDPPIIIFVNQKKGCDVLAKSLEKMGYNACTLHGGKGQEQREFALSN
LKAGAKDILVATDVAGRGIDIQDVSMVVNYDMAKNIEDYIHRIGRTGRAG
Structures of the domain Q9BUQ8 650-759
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jcr X-ray 7 F 651-759 None


© NPIDB team 2003 - 2019

text