Pfam domain
Pfam family: SF3b10 (PF07189.10)
Uniprot AC: Q9BWJ5
RecName: Splicing factor 3B subunit 5
Begin-End: 27-80
Organism: Homo sapiens
Interaction Mode:   

Sequence:
TKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPA
Structures of the domain Q9BWJ5 27-80
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5o9z X-ray 4.5 x 27-79 None


© NPIDB team 2003 - 2019

text