Pfam domain
Pfam family: Ribosomal_L32p (PF01783.22)
Uniprot AC: Q9BYC8
RecName: 39S ribosomal protein L32, mitochondrial
Begin-End: 79-136
Organism: Homo sapiens
Interaction Mode:   

Sequence:
AAPKNRRTIEVNRCRRRNPQKLIKVKNNIDVCPECGHLKQKHVLCAYCYEKVCKETAE
Structures of the domain Q9BYC8 79-136
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j7y X-ray 3.4 0 79-130 None
5oom X-ray 3.03 0 79-130 None


© NPIDB team 2003 - 2019

text