Pfam domain
Pfam family: Ribosomal_L20 (PF00453.17)
Uniprot AC: Q9BYC9
RecName: 39S ribosomal protein L20, mitochondrial
Begin-End: 11-116
Organism: Homo sapiens
Interaction Mode:   

Sequence:
RNRVTDRYFRIQEVLKHARHFRGRKNRCYRLAVRTVIRAFVKCTKARYLKKKNMRTLWIN
RITAASQEHGLKYPALIGNLVKCQVELNRKVLADLAIYEPKTFKSL
Structures of the domain Q9BYC9 11-116
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j7y X-ray 3.4 R 40-157 None
5oom X-ray 3.03 R 15-116 None


© NPIDB team 2003 - 2019

text