Pfam domain
Pfam family: YTH (PF04146.14)
Uniprot AC: Q9BYJ9
RecName: YTH domain-containing family protein 1
Begin-End: 389-524
Organism: Homo sapiens
Interaction Mode:   

Sequence:
GRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDSAFRCMSSKGPVYLLFSVNGSGHFCG
VAEMKSPVDYGTSAGVWSQDKWKGKFDVQWIFVKDVPNNQLRHIRLENNDNKPVTNSRDT
QEVPLEKAKQVLKIIS
Structures of the domain Q9BYJ9 389-524
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4rcj X-ray 1.6 A 390-523 None


© NPIDB team 2003 - 2019

text