Pfam domain
Pfam family: Helicase_C (PF00271.30)
Uniprot AC: Q9BYX4
RecName: Interferon-induced helicase C domain-containing protein 1
Begin-End: 699-826
Organism: Homo sapiens
Interaction Mode:   

Sequence:
EKLTKLRNTIMEQYTRTEESARGIIFTKTRQSAYALSQWITENEKFAEVGVKAHHLIGAG
HSSEFKPMTQNEQKEVISKFRTGKINLLIATTVAEEGLDIKECNIVIRYGLVTNEIAMVQ
ARGRARAD
Structures of the domain Q9BYX4 699-826
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4gl2 X-ray 3.56 B 706-821 None
4gl2 X-ray 3.56 A 706-824 None


© NPIDB team 2003 - 2019

text