Pfam domain
Pfam family: SET (PF00856.30)
Uniprot AC: Q9BZ95
RecName: Histone-lysine N-methyltransferase NSD3
Begin-End: 1156-1262
Organism: Homo sapiens
Interaction Mode:   

Sequence:
GWGLRTKRSIKKGEFVNEYVGELIDEEECRLRIKRAHENSVTNFYMLTVTKDRIIDAGPK
GNYSRFMNHSCNPNCETQKWTVNGDVRVGLFALCDIPAGMELTFNYN
Structures of the domain Q9BZ95 1156-1262
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
7crp X-ray 3.2 I 1156-1262  L-Bb 
7crr X-ray 3.48 I 1156-1262  L-Bb 
7crq X-ray 3.15 I 1156-1262  L-Bb 
7crq X-ray 3.15 L 1156-1262  L-Bb 


© NPIDB team 2003 - 2021

text