Pfam domain
Pfam family: Forkhead (PF00250.17)
Uniprot AC: Q9BZS1
RecName: Forkhead box protein P3
Begin-End: 336-417
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb 

Sequence:
MRPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCF
VRVESEKGAVWTVDELEFRKKR
Structures of the domain Q9BZS1 336-417
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4wk8 X-ray 3.4 F 337-412  H-Bb H-Mj S-Bb 
4wk8 X-ray 3.4 G 337-412  H-Bb 
3qrf X-ray 2.8 F 337-412 None
3qrf X-ray 2.8 G 337-412 None


© NPIDB team 2003 - 2020

text