Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: Q9D2U9
RecName: Histone H2B type 3-A
Begin-End: 34-102
Organism: Mus musculus
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
RKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSR
EVQTAVRLL
Structures of the domain Q9D2U9 34-102
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1u35 X-ray 3 D 1231-1297  H-Bb H-Mj S-Bb L-Bb 
1u35 X-ray 3 H 1429-1497  L-Bb 
2f8n X-ray 2.9 D 1231-1297  H-Bb H-Mj S-Bb L-Bb 
5b1m X-ray 2.34 H 34-100  H-Bb S-Bb L-Bb 
5b1m X-ray 2.34 D 33-100  H-Bb H-Mj S-Bb L-Bb 
5b1l X-ray 2.35 H 34-100  H-Bb H-Mj S-Bb L-Bb 
5b1l X-ray 2.35 D 34-100  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2019

text