Pfam domain
Pfam family: Sigma70_r2 (PF04542.13)
Uniprot AC: Q9EZJ8
RecName: RNA polymerase sigma factor SigA
Begin-End: 202-272
Organism: Thermus aquaticus
Interaction Mode:  H-Bb H-Mj H-Mn L-Bb 

Sequence:
LIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATWWIRQA
INRAIADQART
Structures of the domain Q9EZJ8 202-272
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4xls X-ray 4.01 L 202-271  H-Bb H-Mj 
4xls X-ray 4.01 L 202-271  H-Bb H-Mj 
4xls X-ray 4.01 F 202-271  H-Bb H-Mj 
4xls X-ray 4.01 F 202-271  H-Bb H-Mj 
3ugo X-ray 2.1 A 202-271 None
5tjg X-ray 2.6 F 202-271 None
1l9z X-ray 6.5 H 202-271 None
4xlr X-ray 4.3 F 202-271  H-Bb H-Mj H-Mn 
4xlr X-ray 4.3 L 202-271  H-Bb H-Mj H-Mn 
3ugp X-ray 2.7 A 202-271 None
4ki2 X-ray 3.3 A 202-269 None
4ki2 X-ray 3.3 B 202-271 None
4xlq X-ray 4.6 F 202-271  H-Bb H-Mj H-Mn L-Bb 
4xlq X-ray 4.6 L 202-271  H-Bb H-Mj H-Mn 
4xlp X-ray 4 F 202-271  H-Bb H-Mj H-Mn 
4xlp X-ray 4 L 202-271  H-Bb H-Mj H-Mn 
4xln X-ray 4 F 202-271  H-Bb H-Mj H-Mn 
4xln X-ray 4 L 202-271  H-Bb H-Mj H-Mn 


© NPIDB team 2003 - 2019

text