Pfam domain
Pfam family: Sigma70_r4 (PF04545.15)
Uniprot AC: Q9EZJ8
RecName: RNA polymerase sigma factor SigA
Begin-End: 372-425
Organism: Thermus aquaticus
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
ALSKLSEREAMVLKLRKGLIDGREHTLEEVGAYFGVTRERIRQIENKALRKLKY
Structures of the domain Q9EZJ8 372-425
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4xls X-ray 4.01 L 372-424  H-Bb H-Mj L-Bb L-Mj 
4xls X-ray 4.01 L 372-424  H-Bb H-Mj L-Bb L-Mj 
4xls X-ray 4.01 F 372-424 None
4xls X-ray 4.01 F 372-424 None
3n97 X-ray 3.25 D 375-424 None
3n97 X-ray 3.25 A 375-425  H-Bb H-Mj L-Bb L-Mj 
1ku7 X-ray 2.4 D 372-424 None
1ku7 X-ray 2.4 A 372-424  H-Bb H-Mj L-Bb L-Mj 
5tjg X-ray 2.6 F 372-424 None
1l9z X-ray 6.5 H 372-424 None
4xlr X-ray 4.3 F 372-424 None
4xlr X-ray 4.3 L 372-424 None
1rio X-ray 2.3 H 372-424  H-Bb H-Mj L-Bb L-Mj 
4xlq X-ray 4.6 F 372-424 None
4xlq X-ray 4.6 L 372-424 None
4xlp X-ray 4 F 372-424  H-Bb H-Mj L-Bb L-Mj 
4xlp X-ray 4 L 372-424  H-Bb H-Mj L-Bb L-Mj 
4xln X-ray 4 F 372-424  H-Bb H-Mj L-Bb L-Mj 
4xln X-ray 4 L 372-424  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2019

text