Pfam domain
Pfam family: Sigma70_r1_2 (PF00140.19)
Uniprot AC: Q9EZJ8
RecName: RNA polymerase sigma factor SigA
Begin-End: 94-127
Organism: Thermus aquaticus
Interaction Mode:   

Sequence:
DPVRQYLHEIGQVPLLTLEEEIDLARKVEEGMEA
Structures of the domain Q9EZJ8 94-127
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4xls X-ray 4.01 L 95-127 None
4xls X-ray 4.01 L 95-127 None
4xls X-ray 4.01 F 95-127 None
4xls X-ray 4.01 F 95-127 None
3ugo X-ray 2.1 A 10-127 None
5tjg X-ray 2.6 F 94-127 None
1l9z X-ray 6.5 H 94-127 None
4xlr X-ray 4.3 F 95-127 None
4xlr X-ray 4.3 L 95-127 None
3ugp X-ray 2.7 A 94-127 None
4ki2 X-ray 3.3 A 94-127 None
4ki2 X-ray 3.3 B 94-127 None
4xlq X-ray 4.6 F 95-127 None
4xlq X-ray 4.6 L 95-127 None
4xlp X-ray 4 F 95-127 None
4xlp X-ray 4 L 95-127 None
4xln X-ray 4 F 94-127 None
4xln X-ray 4 L 94-127 None


© NPIDB team 2003 - 2019

text