Pfam domain
Pfam family: Topoisom_I (PF01028.19)
Uniprot AC: Q9GPZ9
RecName: DNA topoisomerase I
Begin-End: 258-456
Organism: Leishmania infantum
Interaction Mode:  H-Bb S-Bb L-Bb L-Mj L-Mn 

Sequence:
SSSVKGQSDMVKFEKARKLKDKVDDIRASYMEDFKSNDLHVAQRAVAMYFIDRLALRVGN
EKGEDEADTVGCCSLRVEHIQLMPDNIVRFDFLGKDSIRYQNDVAVLPEVYALLQRFTRR
KSPGMDIFDQLNPTQLNDHLKSFMDGLSAKVFRTYNASITLDRWFKEKPVDPKWSTADKL
AYFNKANTEVAILCNHQKS
Structures of the domain Q9GPZ9 258-456
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2b9s X-ray 2.27 A 258-456  H-Bb S-Bb L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2020

text