Pfam domain
Pfam family: Topoisom_I_N (PF02919.14)
Uniprot AC: Q9GPZ9
RecName: DNA topoisomerase I
Begin-End: 44-255
Organism: Leishmania infantum
Interaction Mode:  S-Bb S-Mj L-Bb L-Mj L-Mn 

Sequence:
RRWETLAHNGVLFPPEYEPHGIPIFYDGREFKMTPEEEEVATMFAVMKEHDYYRMEVFRR
NFFESWREILDKRQHPIRRLELCDFEPIYQWHLVQREKKLSRTKEEKKAIKEKQDAEAEP
YRYCVWDGRREQVANFRVEPPGLFRGRGKHPLMGKLKVRVQPEDITINIGETAEVPVPPA
GHKWAAVQHDHTVTWLAMWRDSVAGNMKYVML
Structures of the domain Q9GPZ9 44-255
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2b9s X-ray 2.27 A 45-255  S-Bb S-Mj L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2020

text