Pfam domain
Pfam family: RrnaAD (PF00398.22)
Uniprot AC: Q9H5Q4
RecName: Dimethyladenosine transferase 2, mitochondrial
Begin-End: 72-379
Organism: Homo sapiens
Interaction Mode:   

Sequence:
KRYVTDRRLAETLAQIYLGKPSRPPHLLLECNPGPGILTQALLEAGAKVVALESDKTFIP
HLESLGKNLDGKLRVIHCDFFKLDPRSGGVIKPPAMSSRGLFKNLGIEAVPWTADIPLKV
VGMFPSRGEKRALWKLAYDLYSCTSIYKFGRIEVNMFIGEKEFQKLMADPGNPDLYHVLS
VIWQLACEIKVLHMEPWSSFDIYTRKGPLENPKRRELLDQLQQKLYLIQMIPRQNLFTKN
LTPMNYNIFFHLLKHCFGRRSATVIDHLRSLTPLDARDILMQIGKQEDEKVVNMHPQDFK
TLFETIER
Structures of the domain Q9H5Q4 72-379
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6erp X-ray 4.5 J 80-379  H-Bb L-Bb 
6erp X-ray 4.5 F 80-379  H-Bb 
6erq X-ray 4.5 J 80-379  L-Bb 
6erq X-ray 4.5 F 80-379 None


© NPIDB team 2003 - 2021

text