Pfam domain
Pfam family: tRNA_anti-codon (PF01336.27)
Uniprot AC: Q9H668
RecName: CST complex subunit STN1
Begin-End: 57-155
Organism: Homo sapiens
Interaction Mode:   

Sequence:
VDVLGTVIGVRERDAFYSYGVDDSTGVINCICWKKLNTESVSAAPSAARELSLTSQLKKL
QETIEQKTKIEIGDTIRVRGSIRTYREEREIHATTYYKV
Structures of the domain Q9H668 57-155
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6w6w X-ray 3 C 57-155 None


© NPIDB team 2003 - 2021

text