Pfam domain
Pfam family: Piwi (PF02171.16)
Uniprot AC: Q9H9G7
RecName: Protein argonaute-3
Begin-End: 518-819
Organism: Homo sapiens
Interaction Mode:   

Sequence:
LIIVILPGKTPVYAEVKRVGDTLLGMATQCVQVKNVIKTSPQTLSNLCLKINVKLGGINN
ILVPHQRPSVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDAHPSRYCATVRVQRPRQ
EIIQDLASMVRELLIQFYKSTRFKPTRIIFYRDGVSEGQFRQVLYYELLAIREACISLEK
DYQPGITYIVVQKRHHTRLFCADRTERVGRSGNIPAGTTVDTDITHPYEFDFYLCSHAGI
QGTSRPSHYHVLWDDNCFTADELQLLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYH
LV
Structures of the domain Q9H9G7 518-819
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5vm9 X-ray 3.28 A 518-818 None
5vm9 X-ray 3.28 C 518-818 None


© NPIDB team 2003 - 2020

text