Pfam domain
Pfam family: DNA_pol_delta_4 (PF04081.15)
Uniprot AC: Q9HCU8
RecName: DNA polymerase delta subunit 4
Begin-End: 42-97
Organism: Homo sapiens
Interaction Mode:   

Sequence:
EEAELELLRQFDLAWQYGPCTGITRLQRWCRAKQMGLEPPPEVWQVLKTHPGDPRF
Structures of the domain Q9HCU8 42-97
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6tnz X-ray 4.05 D 43-97 None
6s1m X-ray 4.27 D 43-97 None
6s1n X-ray 4.86 D 43-97 None
6s1o X-ray 8.1 D 43-97 None
6tny X-ray 3.08 D 43-97 None


© NPIDB team 2003 - 2021

text