Pfam domain
Pfam family: CTP-dep_RFKase (PF01982.15)
Uniprot AC: Q9HJA6
RecName: Riboflavin kinase
Begin-End: 99-218
Organism: Thermoplasma acidophilum
Interaction Mode:   

Sequence:
VTSGMGEGRYYVARKQYIIQFQEKLGIIPYLGTLNIKVDQASLPELRKIRGFRGIHIEGF
KTEDRTFGSVKAFPAKIQNIPCFVIMPERTVYTDVIEIISDKYLREEINLHDGDRVSVEV
Structures of the domain Q9HJA6 99-218
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5trd X-ray 1.85 A 99-218 None
5trd X-ray 1.85 B 99-218 None


© NPIDB team 2003 - 2019

text