Pfam domain
Pfam family: ThaI (PF15514.5)
Uniprot AC: Q9HJY3
RecName: Uncharacterized protein
Begin-End: 14-215
Organism: Thermoplasma acidophilum
Interaction Mode:  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mj L-Mn 

Sequence:
LFRDRLIIDKVQRRLPYMFQLAELESSRAGKVGMEVGSLRERIISSLLIYKFGEKNVETD
LPITEPEIDVKLFGSPISIKTITGKEPAGVKLIWTVDATKARQFLETWHPRFDLILVHIN
WSSLGGVYYIPDYVQQRIFDEIGKDKYIKLPKQGTNPRGVEISNEALKEIMTDEETMSIK
IEWKKTNVQYNAFKRWVDLWSE
Structures of the domain Q9HJY3 14-215
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3ndh X-ray 1.3 A 14-215  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mj L-Mn 
3ndh X-ray 1.3 B 14-215  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2020

text