Pfam domain
Pfam family: GatB_Yqey (PF02637.17)
Uniprot AC: Q9HVT7
RecName: Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
Begin-End: 328-403
Organism: Pseudomonas aeruginosa
Interaction Mode:   

Sequence:
DYFEKVQGICGDAKLAANWVMVELGSLLNKDGLEIEQSPVSAEQLGGMILRIKDNTISGK
LAKMVFEAMANGEGSA
Structures of the domain Q9HVT7 328-403
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4wj3 X-ray 3.71 K 328-403 None
4wj3 X-ray 3.71 B 328-403 None
4wj3 X-ray 3.71 H 328-403 None
4wj3 X-ray 3.71 E 328-403 None


© NPIDB team 2003 - 2019

text