Pfam domain
Pfam family: FtsK_alpha (PF17854.3)
Uniprot AC: Q9I0M3
RecName: DNA translocase FtsK
Begin-End: 315-415
Organism: Pseudomonas aeruginosa
Interaction Mode:   

Sequence:
LPPLSLLDPAEVKQKSYSPESLEAMSRLLEIKLKEFGVEVSVDSVHPGPVITRFEIQPAA
GVKVSRISNLAKDLARSLAVISVRVVEVIPGKTTVGIEIPN
Structures of the domain Q9I0M3 315-415
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6t8b X-ray 3.65 F 315-415 None
6t8b X-ray 3.65 E 315-415 None
6t8b X-ray 3.65 D 315-415  L-Bb 
6t8b X-ray 3.65 C 315-415 None
6t8b X-ray 3.65 B 315-415 None
6t8b X-ray 3.65 A 315-415 None
6t8o X-ray 3.99 F 315-415 None
6t8o X-ray 3.99 C 315-415 None
6t8o X-ray 3.99 B 315-415 None
6t8o X-ray 3.99 A 315-415 None
6t8o X-ray 3.99 D 315-415 None
6t8o X-ray 3.99 E 315-415 None
6t8g X-ray 4.34 E 315-415 None
6t8g X-ray 4.34 D 315-415 None
6t8g X-ray 4.34 A 315-415 None
6t8g X-ray 4.34 B 315-415 None
6t8g X-ray 4.34 F 315-415 None
6t8g X-ray 4.34 C 315-415 None


© NPIDB team 2003 - 2021

text