Pfam domain
Pfam family: FANC_SAP (PF18081.3)
Uniprot AC: Q9I2N0
RecName: Fanconi-associated nuclease 1 homolog
Begin-End: 105-155
Organism: Pseudomonas aeruginosa
Interaction Mode:  H-Bb L-Bb 

Sequence:
TLELAQLFGLLKKDELSQLFRDHLGRANLRKDALLERLQPLFPEARRLAEW
Structures of the domain Q9I2N0 105-155
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5y7g X-ray 3.4 C 105-155  H-Bb L-Bb 
5y7g X-ray 3.4 B 105-155  H-Bb 
5y7g X-ray 3.4 A 105-155 None
4r89 X-ray 4 A 105-155  H-Bb H-Mj L-Bb 
4r89 X-ray 4 E 105-155  H-Bb H-Mj 
4r8a X-ray 3.2 A 105-155 None
4r8a X-ray 3.2 F 105-155 None
5y7q X-ray 2.7 A 105-155  H-Bb L-Bb 
5z6w X-ray 3.2 A 105-155  L-Bb 


© NPIDB team 2003 - 2021

text