Pfam domain
Pfam family: VRR_NUC (PF08774.10)
Uniprot AC: Q9I2N0
RecName: Fanconi-associated nuclease 1 homolog
Begin-End: 441-553
Organism: Pseudomonas aeruginosa
Interaction Mode:  H-Bb S-Bb L-Bb 

Sequence:
LEDGSYRDAIRCRYRDKFGLQSPFVYWELLGEELLEQALDCLPAAHLRAWFERLLEDIPG
NRAGLPDLIQFWPAQRRYRMVEVKGPGDRLQDNQLRWLQFCREREMPVAVCYV
Structures of the domain Q9I2N0 441-553
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5y7g X-ray 3.4 A 443-555  L-Bb 
5y7g X-ray 3.4 B 443-555  H-Bb S-Bb L-Bb 
5y7g X-ray 3.4 C 443-555  H-Bb S-Bb L-Bb 
4r89 X-ray 4 A 443-553 None
4r89 X-ray 4 E 443-553 None
4r8a X-ray 3.2 A 443-553 None
4r8a X-ray 3.2 F 443-553 None
5y7q X-ray 2.7 A 443-555 None
5z6w X-ray 3.2 A 443-555 None


© NPIDB team 2003 - 2019

text