Pfam domain
Pfam family: Exo_endo_phos (PF03372.22)
Uniprot AC: Q9JJX7
RecName: Tyrosyl-DNA phosphodiesterase 2
Begin-End: 127-359
Organism: Mus musculus
Interaction Mode:   

Sequence:
ITWNIDGLDGCNLPERARGVCSCLALYSPDVVFLQEVIPPYCAYLKKRAASYTIITGNEE
GYFTAILLKKGRVKFKSQEIIPFPNTKMMRNLLCVNVSLGGNEFCLMTSHLESTREHSAE
RIRQLKTVLGKMQEAPDSTTVIFAGDTNLRDQEVIKCGGLPDNVFDAWEFLGKPKHCQYT
WDTKANNNLRIPAAYKHRFDRIFFRAEEGHLIPQSLDLVGLEKLDCGRFPSDH
Structures of the domain Q9JJX7 127-359
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5inq X-ray 1.85 A 128-359 None
5inq X-ray 1.85 B 128-359 None
4gz1 X-ray 1.5 B 128-359 None
4gz1 X-ray 1.5 A 128-359 None
4gz1 X-ray 1.5 A 128-359 None
4gz1 X-ray 1.5 B 128-359 None
4gz0 X-ray 2.11 K 128-359 None
4gz0 X-ray 2.11 I 128-359 None
4gz0 X-ray 2.11 G 128-359 None
4gz0 X-ray 2.11 E 128-359 None
4gz0 X-ray 2.11 B 128-359 None
4gz0 X-ray 2.11 A 128-359 None
4gz2 X-ray 1.85 B 128-359 None
4gz2 X-ray 1.85 A 128-359 None
4gz2 X-ray 1.85 A 128-359 None
4gz2 X-ray 1.85 B 128-359 None
4puq X-ray 1.6 A 128-359 None
4puq X-ray 1.6 B 128-359 None
5ht2 X-ray 1.43 A 128-359 None
5ht2 X-ray 1.43 B 128-359 None
5ink X-ray 2.15 A 128-359 None
5ink X-ray 2.15 B 128-359 None
5inp X-ray 1.95 A 128-359 None
5inp X-ray 1.95 B 128-359 None
5tvp X-ray 2.4 E 128-359 None
5tvp X-ray 2.4 I 128-359 None
5tvp X-ray 2.4 G 128-359 None
5tvp X-ray 2.4 O 128-359 None
5tvp X-ray 2.4 A 128-359 None
5tvp X-ray 2.4 B 128-359 None
5tvp X-ray 2.4 K 128-359 None
5tvp X-ray 2.4 M 128-359 None
5inl X-ray 1.55 B 128-359 None
5inl X-ray 1.55 A 128-359 None


© NPIDB team 2003 - 2020

text