Pfam domain
Pfam family: T-box (PF00907.21)
Uniprot AC: Q9JKD8
RecName: T-box transcription factor TBX21
Begin-End: 138-325
Organism: Mus musculus
Interaction Mode:  S-Bb S-Mj L-Bb L-Mj L-Mn 

Sequence:
VALSNHLLWSKFNQHQTEMIITKQGRRMFPFLSFTVAGLEPTSHYRMFVDVVLVDQHHWR
YQSGKWVQCGKAEGSMPGNRLYVHPDSPNTGAHWMRQEVSFGKLKLTNNKGASNNVTQMI
VLQSLHKYQPRLHIVEVNDGEPEAACSASNTHVFTFQETQFIAVTAYQNAEITQLKIDNN
PFAKGFRE
Structures of the domain Q9JKD8 138-325
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5t1j X-ray 2.95 A 139-326  S-Bb S-Mj L-Bb L-Mj L-Mn 
5t1j X-ray 2.95 B 139-326  S-Bb S-Mj L-Bb L-Mj L-Mn 
5t1j X-ray 2.95 A 139-326  S-Bb S-Mj L-Bb L-Mj L-Mn 
5t1j X-ray 2.95 B 139-326  S-Bb S-Mj L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2019

text