Pfam domain
Pfam family: Exo_endo_phos (PF03372.25)
Uniprot AC: Q9K100
RecName: Exodeoxyribonuclease III
Begin-End: 4-247
Organism: Neisseria meningitidis serogroup B
Interaction Mode:  H-Bb S-Bb L-Bb L-Mj L-Mn 

Sequence:
TTWNVNSLNVRLPQVQNLLADNPPDILVLQELKLDQDKFPAAALQMMGWHCVWSGQKTYN
GVAIVSRSVPQDVHFGLPALPDDPQRRVIAATVSGVRVINVYCVNGEALDSPKFKYKEQW
FAALTEFVRDEMTRHGKLVLLGDFNIAPADADCYDPEKWHEKIHCSSVERQWFQNLLDLG
LTDSLRQVHPEGAFYTWFDYRGAMFQRKLGLRIDHILVSPAMAAALKDVRVDLETRALER
PSDH
Structures of the domain Q9K100 4-247
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fke X-ray 2.15 A 4-247 None
6fk5 X-ray 2.02 A 4-247  H-Bb S-Bb L-Bb L-Mj L-Mn 
6fk4 X-ray 2.3 A 4-247  H-Bb S-Bb L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text