Pfam domain
Pfam family: RNase_H (PF00075.26)
Uniprot AC: Q9KEI9
RecName: Ribonuclease H
Begin-End: 67-179
Organism: Bacillus halodurans
Interaction Mode:  H-Bb H-Mn S-Bb L-Bb L-Mn 

Sequence:
SLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSR
KPIYSDSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPIL
Structures of the domain Q9KEI9 67-179
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2g8f X-ray 1.65 A 68-180 None
2g8w X-ray 2.05 A 68-180 None
6dpo X-ray 1.45 A 68-181 None
2g8v X-ray 1.85 A 68-180 None
4hug X-ray 1.64 B 68-182  H-Bb H-Mn S-Bb L-Bb 
6dpn X-ray 1.49 A 68-181 None
6dpg X-ray 1.38 A 68-181 None
6dph X-ray 1.34 A 68-180 None
5swm X-ray 1.5 A 68-186 None
4huf X-ray 1.69 B 68-182  H-Bb H-Mn S-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2021

text