Pfam domain
Pfam family: RNase_H (PF00075.26)
Uniprot AC: Q9KEI9
RecName: Ribonuclease H
Begin-End: 69-188
Organism: Bacillus halodurans
Interaction Mode:  H-Bb H-Mn S-Bb L-Bb L-Mn 

Sequence:
SVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKP
IYSDSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGE
Structures of the domain Q9KEI9 69-188
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2g8u X-ray 2.7 A 68-186 None
2r7y X-ray 1.8 A 68-186 None
6dok X-ray 1.38 A 68-189 None
1zbi X-ray 1.85 B 68-187 None
1zbi X-ray 1.85 A 68-190 None
3d0p X-ray 1.8 C 68-188 None
3d0p X-ray 1.8 A 68-188 None
6doi X-ray 1.95 A 68-186 None
2g8k X-ray 1.65 A 68-191 None
6dof X-ray 1.43 A 68-190 None
6dog X-ray 1.29 A 68-190 None
2g8h X-ray 1.85 A 68-191 None
3uld X-ray 1.6 A 68-186 None
2g8i X-ray 1.65 A 68-191 None
6doc X-ray 1.5 A 68-190 None
5vaj X-ray 1.95 A 68-190 None
5vaj X-ray 1.95 B 68-187 None
1zbl X-ray 2.2 B 68-188 None
1zbl X-ray 2.2 A 68-188 None
4hug X-ray 1.64 A 68-188  H-Bb H-Mn L-Bb 
4htu X-ray 1.49 B 68-188  H-Bb H-Mn S-Bb L-Bb 
4htu X-ray 1.49 A 68-188  H-Bb H-Mn L-Bb 
4hue X-ray 1.56 A 68-188  H-Bb H-Mn L-Bb 
4hue X-ray 1.56 B 68-188  H-Bb H-Mn L-Bb L-Mn 
6doj X-ray 1.4 A 68-189 None
3twh X-ray 1.79 A 68-188 None
6dpk X-ray 1.39 A 68-189 None
6dpm X-ray 1.68 A 68-190 None
6do8 X-ray 1.41 A 68-189 None
6doa X-ray 1.47 A 68-190 None
6dob X-ray 1.34 A 68-190 None
6dod X-ray 1.54 A 68-190 None
6don X-ray 1.42 A 68-190 None
6doo X-ray 1.44 A 68-190 None
6dop X-ray 1.25 A 68-189 None
6dom X-ray 1.43 A 68-190 None
6dp5 X-ray 1.43 A 68-190 None
6dp6 X-ray 1.4 A 68-190 None
6dp8 X-ray 1.32 A 68-190 None
6dpi X-ray 1.35 A 68-190 None
6dpj X-ray 1.55 A 68-188 None
6doq X-ray 1.42 A 68-190 None
6dor X-ray 1.5 A 68-190 None
6dou X-ray 1.49 A 68-190 None
6doy X-ray 1.45 A 68-189 None
6doz X-ray 1.57 A 68-189 None
6dp1 X-ray 1.42 A 68-189 None
6dp3 X-ray 1.46 A 68-190 None
6dp4 X-ray 1.37 A 68-190 None
6dol X-ray 1.43 A 68-189 None
6dmv X-ray 1.52 A 68-189 None
6dox X-ray 1.45 A 68-190 None
5us2 X-ray 1.9 A 68-186 None
5usa X-ray 1.8 A 68-186 None
5use X-ray 1.73 A 68-186 None
6doh X-ray 1.36 A 68-186 None
3ey1 X-ray 1.6 A 68-188 None
5swm X-ray 1.5 B 68-188 None
5usg X-ray 1.7 A 68-186 None
5w7n X-ray 1.8 A 68-186 None
6dpl X-ray 1.45 A 68-190 None
6dp7 X-ray 1.38 A 68-189 None
4huf X-ray 1.69 A 68-188  H-Bb H-Mn L-Bb L-Mn 
3i8d X-ray 1.61 C 68-186 None
3i8d X-ray 1.61 A 68-186 None
6dp2 X-ray 1.66 A 68-189 None
6dpb X-ray 1.32 A 68-190 None
5w7o X-ray 1.75 A 68-186 None
6dos X-ray 1.32 A 68-189 None
6dpe X-ray 1.56 A 68-190 None
6dpc X-ray 1.34 A 68-190 None
6do9 X-ray 1.36 A 68-190 None
6doe X-ray 1.45 A 68-190 None
6dmn X-ray 1.27 A 68-189 None
6dp0 X-ray 1.45 A 68-189 None
6dov X-ray 1.52 A 68-189 None
6dp9 X-ray 1.4 A 68-188 None
6dpd X-ray 1.46 A 68-190 None
6dpa X-ray 1.49 A 68-188 None
5wjr X-ray 1.7 A 68-186 None
6dow X-ray 1.5 A 68-190 None
6dpf X-ray 1.56 A 68-190 None
6dot X-ray 1.42 A 68-189 None
6dpp X-ray 1.45 A 68-190 None


© NPIDB team 2003 - 2021

text