Pfam domain
Pfam family: RNA_pol_Rpb1_1 (PF04997.11)
Uniprot AC: Q9KWU6
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 2-192
Organism: Thermus aquaticus
Interaction Mode:  L-Bb 

Sequence:
KKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACG
KYKRQRFEGKVCERCGVEVTRSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSAT
ELEQVLYFNKYIVLDPKGAVLDGVPVEKRQLLTDEEYRELRYGKQETYPLPAGVDALVKD
GEEVVKGQELA
Structures of the domain Q9KWU6 2-192
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4xls X-ray 4.01 D 2-159  L-Bb 
4xls X-ray 4.01 D 2-159  L-Bb 
5tjg X-ray 2.6 D 2-159 None
4xlr X-ray 4.3 D 2-159 None
4xlq X-ray 4.6 D 2-159  L-Bb 
4xlp X-ray 4 D 2-159  L-Bb 
4xln X-ray 4 D 2-159 None


© NPIDB team 2003 - 2019

text