Pfam domain
Pfam family: RNA_pol_Rpb1_2 (PF00623.19)
Uniprot AC: Q9KWU6
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 620-765
Organism: Thermus aquaticus
Interaction Mode:   

Sequence:
GKRVDYSGRSVIVVGPQLKLHQCGLPKRMALELFKPFLLKKMEEKAFAPNVKAARRMLER
QRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVLVEGQSIQLHPLVCEAFNAD
FDGDQMAVHVPLSSFAQAEARIQMLS
Structures of the domain Q9KWU6 620-765
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4xls X-ray 4.01 J 620-761 None
4xls X-ray 4.01 J 620-761 None
4xls X-ray 4.01 D 620-761 None
4xls X-ray 4.01 D 620-761 None
5tjg X-ray 2.6 D 620-761 None
1l9z X-ray 6.5 D 620-761 None
4xlr X-ray 4.3 D 620-761 None
4xlr X-ray 4.3 J 620-761 None
4xlq X-ray 4.6 D 620-761 None
4xlq X-ray 4.6 J 620-761 None
4xlp X-ray 4 D 620-761 None
4xlp X-ray 4 J 620-761 None
4xln X-ray 4 D 620-761 None
4xln X-ray 4 J 620-761 None


© NPIDB team 2003 - 2019

text