Pfam domain
Pfam family: RNA_pol_Rpb2_1 (PF04563.14)
Uniprot AC: Q9KWU7
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 17-380
Organism: Thermus aquaticus
Interaction Mode:   

Sequence:
PLTEIQVESYKKALQADVPPEKRENVGIQAAFKETFPIEEGDKGKGGLVLDFLEYRIGDP
PFSQDECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHLPLMTEDGSFIINGADRVI
VSQIHRSPGVYFTPDPARPGRYIASIIPLPKRGPWIDLEVEASGVVTMKVNKRKFPLVLL
LRVLGYDQETLVRELSAYGDLVQGLLDEAVLAMRPEEAMVRLFTLLRPGDPPKKDKALAY
LFGLLADPKRYDLGEAGRYKAEEKLGVGLSGRTLVRFEDGEFKDEVFLPTLRYLFALTAG
VPGHEVDDIDHLGNRRIRTVGELMADQFRVGLARLARGVRERMVMGSPDTLTPAKLVNSR
PLEA
Structures of the domain Q9KWU7 17-380
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4xls X-ray 4.01 I 18-379 None
4xls X-ray 4.01 I 18-379 None
4xls X-ray 4.01 C 18-379 None
4xls X-ray 4.01 C 18-379 None
5tjg X-ray 2.6 C 18-379 None
1l9z X-ray 6.5 C 18-379 None
4xlr X-ray 4.3 C 18-379 None
4xlr X-ray 4.3 I 18-379 None
4xlq X-ray 4.6 C 18-379 None
4xlq X-ray 4.6 I 18-379 None
4xlp X-ray 4 C 18-379 None
4xlp X-ray 4 I 18-379 None
4xln X-ray 4 C 18-379 None
4xln X-ray 4 I 18-379 None


© NPIDB team 2003 - 2019

text